I thought nuclear-encoded human proteins always began with methionine?
Response: The UCSC genome browser uses mRNA data exactly as supplied to GenBank by the original sequencing authors. Any errors at GenBank propagate through many other databases and tools. To work effectively in a bioinformatic area subject to errors, it is a good idea to seek supporting data for any unusual finding. In the case of KIAA1247, by using Blat or Blast to recover other close members of this human gene family (GNS, SGSH, ARSA, ARSB, GALNS, ARSE, ARSD, STS, and IDS), you would quickly learn through alignment that the 5’UTR in mRNA for KIAA1247 was more likely misintepreted as coding sequence and that the protein begins with methionine as expected: dsripkeapdqqkkkMGPPSLVLCLLS… In the case of KIAA1077, the underlying mRNA at GenBank stopped short of the initiator methionine. Here you might use ESTs, other mRNAs, and and Blat or Blast of paralogs against unfinished HTGS genome to recover a more plausible full-length sequence by homology, namely: MKYSCCALVLAVLGTELLGSLCSTVRSPRFRG
